PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G224900.1
Common NamePHAVU_002G224900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NAC
Protein Properties Length: 351aa    MW: 38934.4 Da    PI: 8.9402
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G224900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.27.9e-54151421128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yLk+k+++++l++  +i++vd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+
  Phvul.002G224900.1  15 LPPGFRFHPTDEELVVHYLKRKASSTPLPV-AIIADVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDKP 104
                         79****************************.88***************8888999************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +l++ ++++vg+kk Lvfy g+ pkg+kt+W+mheyrl
  Phvul.002G224900.1 105 ILTSdGHQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL 142
                         **9967788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-658178IPR003441NAC domain
PROSITE profilePS5100561.31315178IPR003441NAC domain
PfamPF023653.0E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MDSTDSSSAS QHPHLPPGFR FHPTDEELVV HYLKRKASST PLPVAIIADV DLYKFDPWEL  60
PSKATFGEQE WYFFSPRDRK YPNGVRPNRA ATSGYWKATG TDKPILTSDG HQKVGVKKAL  120
VFYGGKPPKG VKTNWIMHEY RLVHDSFNST SKPPPLVPPN KKNSLRLDNW VLCRIYKKSN  180
SSILTRPPLM EQGEELSMEN MLPTMSTLSM ANNNTQNSKP QSSRGTSYGP LGLENDDNFF  240
DGILAVDHQS MQSGSDSHLF SPNSKGGNFP MKRALTSQQL WNETGSPGSS SSCKRFHGDL  300
NSGTEDNDSF VSLLSQFPQN ATFQPNAIHG SVGDGAQRQQ QFQLPGINWN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-741518217169NO APICAL MERISTEM PROTEIN
1ut4_B1e-741518217169NO APICAL MERISTEM PROTEIN
1ut7_A1e-741518217169NO APICAL MERISTEM PROTEIN
1ut7_B1e-741518217169NO APICAL MERISTEM PROTEIN
3swm_A2e-741518220172NAC domain-containing protein 19
3swm_B2e-741518220172NAC domain-containing protein 19
3swm_C2e-741518220172NAC domain-containing protein 19
3swm_D2e-741518220172NAC domain-containing protein 19
3swp_A2e-741518220172NAC domain-containing protein 19
3swp_B2e-741518220172NAC domain-containing protein 19
3swp_C2e-741518220172NAC domain-containing protein 19
3swp_D2e-741518220172NAC domain-containing protein 19
4dul_A1e-741518217169NAC domain-containing protein 19
4dul_B1e-741518217169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159283.10.0hypothetical protein PHAVU_002G224900g
SwissprotQ8GY421e-111NAC25_ARATH; NAC transcription factor 25
TrEMBLV7CM580.0V7CM58_PHAVU; Uncharacterized protein
STRINGGLYMA07G31220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-105NAC domain containing protein 25